PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_182430_wwwi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 156aa    MW: 18229.9 Da    PI: 9.6566
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_182430_wwwi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-192172556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         ++tkeq++ Le+ F+ +r+++ +++ +LA++lg+++rqV +W+qN+Ra++k
  Bv8_182430_wwwi.t1 21 KRLTKEQVRLLEASFKLDRKLDMDRKFHLAQELGIPTRQVAIWYQNKRARWK 72
                        679************************************************9 PP

2HD-ZIP_I/II1032.5e-3320110393
         HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                          +rl+keqv+lLE sF+ ++kL+ +rK +la+eLg+ +rqva+W+qn+RAR+k++ lE+ y++L++++++   en+rLekev++L +el++
  Bv8_182430_wwwi.t1  20 NKRLTKEQVRLLEASFKLDRKLDMDRKFHLAQELGIPTRQVAIWYQNKRARWKSQSLEMGYKTLQQRLESALVENKRLEKEVQRLSNELEN 110
                         58************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-18975IPR009057Homeodomain-like
PROSITE profilePS5007115.2081474IPR001356Homeobox domain
SMARTSM003896.4E-161778IPR001356Homeobox domain
PfamPF000464.9E-162172IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-192281IPR009057Homeodomain-like
CDDcd000862.32E-132275No hitNo description
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
Gene3DG3DSA:1.20.5.1701.7E-482117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MYSPKTTHNK KHEPHPKCTN KRLTKEQVRL LEASFKLDRK LDMDRKFHLA QELGIPTRQV  60
AIWYQNKRAR WKSQSLEMGY KTLQQRLESA LVENKRLEKE VQRLSNELEN MNQMLVASTS  120
TASPNSYVCN EEDASGLMIG DQPNSFFPRD LYACLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686481.11e-115PREDICTED: homeobox-leucine zipper protein ATHB-52
TrEMBLA0A0J8BTX81e-115A0A0J8BTX8_BETVU; Uncharacterized protein
STRINGVIT_10s0003g00380.t012e-45(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.16e-32homeobox protein 52